1. 1 month ago  from bookmarklet
    (via Total Gibberish - Funny Facebook Status Messages and Facebook Fails)
     
  2. Notes: 1 / 1 month ago  from bookmarklet
  3. Notes: 29 / 1 month ago  from captaiinplanet (originally from dubardo)

    (Source: dubardo)

     
  4. 1 month ago 
    Taken with Instagram at The Atlas

    Taken with Instagram at The Atlas

     
  5. Notes: 3 / 1 month ago  from bookmarklet
    How to transfer a domain from GoDaddy (Transfer To Namecheap) • Namecheap.com Knowledgebase
  6. 1 month ago  from bookmarklet
    (via Ctrl Alt Del - On the go (2011-12-16))
     
  7. 1 month ago  from bookmarklet
    science! (via OhGizmo! » Archive » Surprise: X-Ray App That Lets You See Under Catalog Models’ Clothing Actually Boosts Sales)
     
  8. 1 month ago  from bookmarklet
    (via Programmers vs Users)
     
  9. Notes: 79 / 2 months ago  from zero1infinity

    (Source: zero1infinity)

     
  10. 2 months ago  from bookmarklet
    (via Macro Cell Lens Band)
     
  11. Notes: 1356 / 2 months ago  from daiseemerollin (originally from observando)
     
  12. 2 months ago  from bookmarklet

    Awesome Series - PokeAwesome - Just a Pokemon Battle (by egoraptor)

  13. 2 months ago 
    Fitz and the Tantrums - Bluebird, a set on Flickr.
     
  14. Notes: 39 / 2 months ago  from shitmystudentswrite

    They could be crated for up to 8 hours.

    shitmystudentswrite:

    During the nineteenth century women had to be domesticated while their husbands went out into the social world.

  15. 2 months ago  from bookmarklet
    Fliers Still Must Turn Off Devices, but It's Not Clear Why - NYTimes.com
avatar_128
 
 
Photo Credit: Rob Allen
Chance Garcia is a Web Systems architect/engineer/manager Specialist who occasionally doesn't fail at his job. Also, most of the time I don't refer to myself in the third person.
I've been working in a *AMP environment since 2006. Tumblr and Twitter is my most active activity when it comes to blogging.
I have recently been trying to document my career progress at my 'professional' blog Internet Strategy Guide.
If you would like to look at my portfolio, you can see it at http://chancegarcia.com/resume/portfolio
 
 

Following

thenerdssexysanctuarysmellslikechildrenntsurocketsthenakedbusinessmanlilykilycourtenaybirdfaiththevampireslayeragentmlovestacoskittenskittenskittensclientsfromhellpeechizdo-overmakememakethatfuckinsoundesbuenozero1infinityimanerdibitebgebstredicimaxbeattydaiseemerollinfinermacstaffjessica-reedskooptextsfrombennettwhat-hurts-the-m0stbarangurteialmostlaugheriisradtrotzketflnshitmystudentswritethisfeliciadaybetsytrotzke85percentfineglambiguousjuliaroyjennepennedrake1701maggie1000lmcalpinshitzonsayslaripkmyparentsjoinedfacebooktswicegoodtamarwkylehaskinsfmylifekatrinahilliarydescendsjacobdxkcdexplainedfreedomfrompornthegeekroomspandaappreviewthisiswhyyourefatreversecowgirlgnomenclatureemeuppersphere
 

Tumblr