Posts tagged "comic"
  1. 1 year ago  from bookmarklet
    Comic explains the fight over music copyrights - Boing Boing

    Comic explains the fight over music copyrights - Boing Boing

     
  2. 1 year ago  from bookmarklet
    Disney’s Princesses Reimagined As Comic Book Heroines - disney princess - io9

    Disney’s Princesses Reimagined As Comic Book Heroines - disney princess - io9

     
  3. Notes: 5 / 1 year ago  from tsurockets
    (via tsurockets)

    (via tsurockets)

     
  4. 1 year ago  from tsurockets (originally from fuckyeahthor)
    tsurockets: moeoftoe:emonerdcorp:sometimesitstoomuch:fuckyeahshellhead:fuckyeahthor: LOL I have something related to this. It’s gotta be somewhere.

    tsurockets:

    moeoftoe:emonerdcorp:sometimesitstoomuch:fuckyeahshellhead:fuckyeahthor:

    LOL

    I have something related to this. It’s gotta be somewhere.

     
  5. 1 year ago  from tsurockets
    tsurockets: while we’re on the subject of my attention span…

    tsurockets:

    while we’re on the subject of my attention span…

     
  6. Notes: 41 / 1 year ago  from bookmarklet
    LOST in Comics - The Uncanny Archetypes

    LOST in Comics - The Uncanny Archetypes

     
  7. 1 year ago  from ialmostlaugh (originally from blackbettyshoes)
    ialmostlaugh: blackbettyshoes: LOL…classic via www.vgcats.com

    ialmostlaugh:

    blackbettyshoes:

    LOL…classic

    via www.vgcats.com

     
  8. 1 year ago  from bookmarklet
    Random Domain - M for more

    Random Domain - M for more

     
  9. 1 year ago  from ialmostlaugh
    (via ialmostlaugh)

    (via ialmostlaugh)

     
  10. 1 year ago  from ialmostlaugh
    no flash for you (via ialmostlaugh)

    no flash for you (via ialmostlaugh)

     
  11. Notes: 4 / 1 year ago  from drake1701
    draake: Ctrl+Alt+Del - Comics - Cad - Skag bait (2010-03-15)

    draake:

    Ctrl+Alt+Del - Comics - Cad - Skag bait (2010-03-15)

     
  12. 1 year ago 
    How to Teach Yourself Programming in 21 days.

    How to Teach Yourself Programming in 21 days.

     
  13. 1 year ago  from bookmarklet
    Questionable Content: New comics every Monday through Friday

    Questionable Content: New comics every Monday through Friday

     
  14. 2 years ago  from lilykily
    lilykily: aww, poor widdle bunny. http://www.elfwood.com/~manydeeds/Lunetra.3009163.html

    lilykily:

    aww, poor widdle bunny.

    http://www.elfwood.com/~manydeeds/Lunetra.3009163.html

     
  15. 2 years ago  from bookmarklet
    Superman’s Latest Origins Tease And Please - Superman secret origins - io9

    Superman’s Latest Origins Tease And Please - Superman secret origins - io9

     
avatar_128
 
 
Photo Credit: Rob Allen
Chance Garcia is a Web Systems architect/engineer/manager Specialist who occasionally doesn't fail at his job. Also, most of the time I don't refer to myself in the third person.
I've been working in a *AMP environment since 2006. Tumblr and Twitter is my most active activity when it comes to blogging.
I have recently been trying to document my career progress at my 'professional' blog Internet Strategy Guide.
If you would like to look at my portfolio, you can see it at http://chancegarcia.com/resume/portfolio
 
 

Following

thenerdssexysanctuarysmellslikechildrenntsurocketsthenakedbusinessmanlilykilycourtenaybirdfaiththevampireslayeragentmlovestacoskittenskittenskittensclientsfromhellpeechizdo-overmakememakethatfuckinsoundesbuenozero1infinityimanerdibitebgebstredicimaxbeattydaiseemerollinfinermacstaffjessica-reedskooptextsfrombennettwhat-hurts-the-m0stbarangurteialmostlaugheriisradtrotzketflnshitmystudentswritethisfeliciadaybetsytrotzke85percentfineglambiguousjuliaroyjennepennedrake1701maggie1000lmcalpinshitzonsayslaripkmyparentsjoinedfacebooktswicegoodtamarwkylehaskinsfmylifekatrinahilliarydescendsjacobdxkcdexplainedfreedomfrompornthegeekroomspandaappreviewthisiswhyyourefatreversecowgirlgnomenclatureemeuppersphere
 

Tumblr