Posts tagged "tech"
  1. Notes: 3 / 1 month ago  from bookmarklet
    How to transfer a domain from GoDaddy (Transfer To Namecheap) • Namecheap.com Knowledgebase
  2. 1 month ago  from bookmarklet
    science! (via OhGizmo! » Archive » Surprise: X-Ray App That Lets You See Under Catalog Models’ Clothing Actually Boosts Sales)
     
  3. Notes: 16 / 3 months ago  from bookmarklet
    (via Saturday Morning Breakfast Cereal)
     
  4. Notes: 1 / 1 year ago  from bookmarklet
  5. 1 year ago  from bookmarklet
    Robot exoskeleton for kids
ED-200 prototype?

    Robot exoskeleton for kids

    ED-200 prototype?

     
  6. 1 year ago  from bookmarklet
    OhGizmo! » Archive » Jorno Folding Bluetooth Keyboard
     
  7. 1 year ago  from bookmarklet
    Insync Is Dropbox For Google Users (Special Offer For CrunchBase Companies)

    this looks promising. can’t wait to see how they price above free.

  8. 1 year ago  from bookmarklet
    OhGizmo! » Archive » Sonic Nausea Device
     
  9. 1 year ago  from bookmarklet
    The Secret Histories of Those @#$%ing Computer Symbols | Gadget Lab | Wired.com
     
  10. 1 year ago  from bookmarklet
    OhGizmo! » Archive » Sharpie Unveils The Liquid Pencil
     
  11. 1 year ago  from bookmarklet
    Paul Loeb: What if Verizon Could Censor Your Telephone Conversations: Why Net Neutrality Matters
  12. Notes: 2 / 1 year ago  from zero1infinity
    zero1infinity:

Old school numpad :)

    zero1infinity:

    Old school numpad :)

     
  13. 1 year ago  from bookmarklet
    OhGizmo! » Archive » iSafe Bags Have A Deafening Secret Weapon
     
  14. 1 year ago  from trotzke
    What The Combine technology conference has to offer Indiana

    trotzke:

    Bloomington, Indiana will be hosting the inaugural year of The Combine from September 9th through 12th. You might expect that the first year for this type of event would struggle to draw much in the…

  15. 1 year ago  from bookmarklet
    Sound Blaster World Of Warcraft Tap Chat Foot Pedal
PTT and jump is all i’m saying.

    Sound Blaster World Of Warcraft Tap Chat Foot Pedal

    PTT and jump is all i’m saying.

     
avatar_128
 
 
Photo Credit: Rob Allen
Chance Garcia is a Web Systems architect/engineer/manager Specialist who occasionally doesn't fail at his job. Also, most of the time I don't refer to myself in the third person.
I've been working in a *AMP environment since 2006. Tumblr and Twitter is my most active activity when it comes to blogging.
I have recently been trying to document my career progress at my 'professional' blog Internet Strategy Guide.
If you would like to look at my portfolio, you can see it at http://chancegarcia.com/resume/portfolio
 
 

Following

thenerdssexysanctuarysmellslikechildrenntsurocketsthenakedbusinessmanlilykilycourtenaybirdfaiththevampireslayeragentmlovestacoskittenskittenskittensclientsfromhellpeechizdo-overmakememakethatfuckinsoundesbuenozero1infinityimanerdibitebgebstredicimaxbeattydaiseemerollinfinermacstaffjessica-reedskooptextsfrombennettwhat-hurts-the-m0stbarangurteialmostlaugheriisradtrotzketflnshitmystudentswritethisfeliciadaybetsytrotzke85percentfineglambiguousjuliaroyjennepennedrake1701maggie1000lmcalpinshitzonsayslaripkmyparentsjoinedfacebooktswicegoodtamarwkylehaskinsfmylifekatrinahilliarydescendsjacobdxkcdexplainedfreedomfrompornthegeekroomspandaappreviewthisiswhyyourefatreversecowgirlgnomenclatureemeuppersphere
 

Tumblr